PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P04480_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 421aa    MW: 47676.8 Da    PI: 8.4585
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P04480_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.4e-082633001954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps  ++  LA+k gL+ +qV++WF N R +
  GSMUA_Achr4P04480_001 263 FEHflHPYPSDVDKVILARKAGLSRSQVSNWFINARVR 300
                            664459******************************88 PP

2BELL1024.4e-33152220472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            el+k kakL s+leeVd+rY++y+eq+++v+ssFe++ag g+a +Y +lA+ka+SrhFr Lkd i++qi
  GSMUA_Achr4P04480_001 152 ELHKLKAKLFSMLEEVDRRYRKYCEQMKAVVSSFETMAGEGAADIYSTLASKAMSRHFRRLKDGIVDQI 220
                            89999***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-3996218IPR006563POX domain
PfamPF075263.8E-4198216IPR006563POX domain
PROSITE profilePS5007111.499241304IPR001356Homeobox domain
CDDcd000861.73E-10244305No hitNo description
SMARTSM003891.8E-7244308IPR001356Homeobox domain
SuperFamilySSF466891.24E-16245312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-26247310IPR009057Homeodomain-like
PfamPF059201.0E-16261300IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MLGVPSKRQG SHFMKNFVHR SLPESSNGNF GMGSAVSTWP VDDSSSISLF NCQEGEQLDR  60
KLSLSHFSVK SPDGIGLPDS LQQQQQQLFV HARREHYLKK SKYLKPTQEL LSEFCNIQEG  120
LNSKEGPKQG SRREEGDPSS WQQSLYSMNH LELHKLKAKL FSMLEEVDRR YRKYCEQMKA  180
VVSSFETMAG EGAADIYSTL ASKAMSRHFR RLKDGIVDQI NAVKKAMGET DPTLQHGMVQ  240
QLPWRPQRGL PERSVSILRA WLFEHFLHPY PSDVDKVILA RKAGLSRSQV SNWFINARVR  300
IWKPMVEEMY SEEMKELDAK SNQNPNPNSA LSLVHKPFLN DSESLSSIIN SSHHGVHQPQ  360
QQRVSGADHF GVVDYDVFSS YSNFASDDLR RSGELSMLDG EAQGVPRRTL MGTQLLHDLA  420
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-15250308563Homeobox protein Meis2
3k2a_B3e-15250308563Homeobox protein Meis2
4xrm_A3e-15250308563Homeobox protein Meis2
4xrm_B3e-15250308563Homeobox protein Meis2
4xrs_A3e-15250307158Homeobox protein Meis1
4xrs_B3e-15250307158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395309.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388977e-74BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM0SL150.0M0SL15_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P04480_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-72TALE family protein